SKU: 69750297576

Human VAV1 (SH3-2) Protein

Sale price$189.00 Regular price$210.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human VAV1 (SH3-2) ProteinProduct Specification Species Human Synonyms Proto oncogene vav, VAV Accession P15498 Amino Acid Sequence Protein sequence (P15498, Lys782 Cys845) KYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC Expression System E. coli Molecular Weight Predicted MW: 7. 6 kDa Observed MW: 10 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized powder Storage Buffer Lyophilized from a 0. 2

Product Specification


Species Human
Synonyms Proto-oncogene vav, VAV
Accession P15498
Amino Acid Sequence

Protein sequence (P15498, Lys782-Cys845) KYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC

Expression System E.coli
Molecular Weight Predicted MW: 7.6 kDa Observed MW: 10 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

VAV1 is a crucial signaling protein that belongs to the VAV family of guanine nucleotide exchange factors (GEFs). It plays a pivotal role in hematopoietic cells, where it regulates cytoskeletal dynamics, cell migration, and immune responses by activating Rho-family GTPases such as Rac1 and Cdc42. The protein contains multiple functional domains, including a Dbl homology (DH) domain for GEF activity, a pleckstrin homology (PH) domain, and two Src homology 3 (SH3) domains, with the second SH3 domain (SH3-2) mediating protein-protein interactions. VAV1 is primarily expressed in T cells, B cells, and natural killer (NK) cells, where it participates in T-cell receptor (TCR) and B-cell receptor (BCR) signaling pathways. Dysregulation of VAV1 has been linked to autoimmune diseases and hematological malignancies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69750297576

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 1269 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kindle Customer
Charlottesville, US
★★★★★ 4
great concept, just one tiny annoyance...
Color: Black, Grey
i love that a sock that lets your toes be free is even a thing that exists. i love that this company was started by a young girl, now turned young businesswoman. i have pain in my big toes, so i can't wear close toed anything, but feet get stinky if you wear shoes/slippers all the time without socks. this is a great solution. the only thing i find slightly annoying (not enough to stop using these) is the seam on the bottom of your foot, near the base of the toes. it is a straight line, which is fine on the top of the foot, but i wish the bottom itself curved a bit, to follow the line of the toes. as it is, the seam lands right in the middle if the ball of my feet, so i can feel the seams everytime i take a step. i am constantly pulling the seam toward the toes, to try to keep from feeling it, but then my pinky toe gets caught and balled up on the inside. outside of that slight annoyance, they're comfortable and fit well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2022
J
Verified Purchase
Jennifer F.
Bozeman, US
★★★★★ 5
Good fit
Color: Black and Gray Argyle
I wear a size 9 shoe and these fit well. They are a little snug, but not too tight.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
P
Verified Purchase
Polly Wayne
Battle Creek, US
★★★★★ 5
A little expensive but really come in handy!
Color: Black, Grey
So far I am really happy with these socks. I broke my big toe and had to have my toenail removed and am wearing a post-op shoe/boot. I wanted to wear a sock underneath so that my foot wouldn't get too sweaty but my toe is still too tender for regular socks and cutting the toes off of regular socks doesn't work because they won't stay put. These work great- I actually pull them up over my little toes and just leave my first couple of toes exposed. I really like that you can wear these on either foot (unlike some open toed socks that have openings for the big toe and the rest of your toes so they are designated for left and right foot) since I'm only using them on my right foot.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 8, 2023
K
Verified Purchase
KP
Natrona Heights, US
★★★★★ 3
Excellent idea, could be better executed
I love the idea, but my problem with this product is that the bottom of the socks are made too short. The socks tend to slouch up when you wear them for awhile, so the entire ball of your foot will be exposed at some point. I would like to find a pair that cover the ball of the foot as well. But the socks are well made and attractive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2019
J
Verified Purchase
Jasmine Takhtalian
New York, US
★★★★★ 5
Perfect Solution for Moisturizing Heels Without Full Socks
Color: Black, Grey
Excellent quality and incredibly soft! These toeless socks are perfect if you like to moisturize your heels but don’t want to wear full socks. They stay in place and keep the lotion where it needs to be—highly recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2025

recommand products